- ANO3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88546
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: DKRNTFEKNL RAEGLMLEKE PAIASPDIMF IKIHIPWDTL CKYAERLNIR MPFRKKCYYT DGRSKSMGRM QTYFRRIKNW MAQNPM
- DYT24, TMEM16C, DYT23, GENX-3947, C11orf25
- Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- ANO3
- Unconjugated
- Human
- anoctamin 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 115 kDa
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
DKRNTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGRSKSMGRMQTYFRRIKNWMAQNPM
Specifications/Features
Available conjugates: Unconjugated